SCOP 1.71: Domain d1a5v__: 1a5v -

Lineage for d1a5v__ (1a5v -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)

8. Domain d1a5v__: 1a5v - [33629]
   complexed with mn, y3

Details for d1a5v__

PDB Entry: 1a5v, 1.9 Å

PDB Description: asv integrase core domain with hiv-1 integrase inhibitor y3 and mn cation

SCOP Domain Sequences for d1a5v__:

Sequence; same for both SEQRES and ATOM records:

>d1a5v__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1a5v__:

• d1a5v__ first appeared (with stable ids) in SCOP 1.55
  
• d1a5v__ appears in SCOP 1.69
  
• d1a5v__ is called d1a5va_ in SCOP 1.73
  
• d1a5v__ appears in the current release, SCOPe 2.08, called d1a5va_