![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) ![]() |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (3 species) |
![]() | Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries) |
![]() | Domain d1a5v__: 1a5v - [33629] |
PDB Entry: 1a5v (more details), 1.9 Å
SCOP Domain Sequences for d1a5v__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5v__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)} glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg dgfmkriptskqgellakamyalnhf
Timeline for d1a5v__: