![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
![]() | Protein Retroviral integrase, catalytic domain [53108] (5 species) |
![]() | Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries) |
![]() | Domain d1a5va_: 1a5v A: [33629] complexed with mn, y3 |
PDB Entry: 1a5v (more details), 1.9 Å
SCOPe Domain Sequences for d1a5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5va_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]} glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg dgfmkriptskqgellakamyalnhf
Timeline for d1a5va_: