![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (3 species) |
![]() | Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries) |
![]() | Domain d1asw__: 1asw - [33627] complexed with epe, ipa; mutant |
PDB Entry: 1asw (more details), 1.8 Å
SCOP Domain Sequences for d1asw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asw__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)} reprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv laegdgfmkriptskqgellakamyalnhfer
Timeline for d1asw__: