SCOP 1.63: Domain d1asw__: 1asw -

Lineage for d1asw__ (1asw -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)

8. Domain d1asw__: 1asw - [33627]
   complexed with epe, ipa; mutant

Details for d1asw__

PDB Entry: 1asw, 1.8 Å

PDB Description: avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c

SCOP Domain Sequences for d1asw__:

Sequence; same for both SEQRES and ATOM records:

>d1asw__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
reprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
laegdgfmkriptskqgellakamyalnhfer

Timeline for d1asw__:

• d1asw__ first appeared (with stable ids) in SCOP 1.55
  
• d1asw__ appears in SCOP 1.61
  
• d1asw__ appears in SCOP 1.65
  
• d1asw__ appears in the current release, SCOPe 2.08, called d1aswa_