Lineage for d1asw__ (1asw -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25292Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 25293Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 25321Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)
  8. 25328Domain d1asw__: 1asw - [33627]

Details for d1asw__

PDB Entry: 1asw (more details), 1.8 Å

PDB Description: avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c

SCOP Domain Sequences for d1asw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asw__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
reprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwatai
avlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirv
laegdgfmkriptskqgellakamyalnhfer

SCOP Domain Coordinates for d1asw__:

Click to download the PDB-style file with coordinates for d1asw__.
(The format of our PDB-style files is described here.)

Timeline for d1asw__: