Lineage for d1c0ta1 (1c0t A:430-539)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25218Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 25219Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)
  8. 25229Domain d1c0ta1: 1c0t A:430-539 [33606]
    Other proteins in same PDB: d1c0ta2, d1c0tb1

Details for d1c0ta1

PDB Entry: 1c0t (more details), 2.7 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326

SCOP Domain Sequences for d1c0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

SCOP Domain Coordinates for d1c0ta1:

Click to download the PDB-style file with coordinates for d1c0ta1.
(The format of our PDB-style files is described here.)

Timeline for d1c0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0ta2
View in 3D
Domains from other chains:
(mouse over for more information)
d1c0tb1