Lineage for d5lowb_ (5low B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045317Protein automated matches [190234] (3 species)
    not a true protein
  7. 2045326Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (9 PDB entries)
  8. 2045341Domain d5lowb_: 5low B: [335811]
    Other proteins in same PDB: d5lowd1, d5lowd2, d5lowe_, d5lowf_, d5lowg1, d5lowg2, d5lowk1, d5lowk2, d5lowl_, d5lowm_, d5lown1, d5lown2
    automated match to d3rpba_
    complexed with ca, gol

Details for d5lowb_

PDB Entry: 5low (more details), 2.8 Å

PDB Description: structure of the ca2+-bound rabphilin 3a c2b domain snap25 complex (p21 space group)
PDB Compounds: (B:) rabphilin-3a

SCOPe Domain Sequences for d5lowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lowb_ b.7.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dieergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhkt
qikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlk
hwyeclknkdkkierwhqlqnenh

SCOPe Domain Coordinates for d5lowb_:

Click to download the PDB-style file with coordinates for d5lowb_.
(The format of our PDB-style files is described here.)

Timeline for d5lowb_: