| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein automated matches [190234] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries) |
| Domain d5lowb_: 5low B: [335811] Other proteins in same PDB: d5lowd1, d5lowd2, d5lowe_, d5lowf_, d5lowg1, d5lowg2, d5lowk1, d5lowk2, d5lowl_, d5lowm_, d5lown1, d5lown2 automated match to d3rpba_ complexed with ca, gol |
PDB Entry: 5low (more details), 2.8 Å
SCOPe Domain Sequences for d5lowb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lowb_ b.7.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dieergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhkt
qikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlk
hwyeclknkdkkierwhqlqnenh
Timeline for d5lowb_: