SCOPe 2.08: Domain d5paga_: 5pag A:

Lineage for d5paga_ (5pag A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d5paga_: 5pag A: [335736]
   Other proteins in same PDB: d5pagb_
   automated match to d1klil_
   complexed with 7yj, ca, cl, gol, so4

Details for d5paga_

PDB Entry: 5pag, 1.36 Å

PDB Description: crystal structure of factor viia in complex with (2r)-2-hydroxy-n-[[3- [5-hydroxy-4-(1h-pyrrolo[3,2-c]pyridin-2-yl)pyrazol-1- yl]phenyl]methyl]-3-methylbutanamide;hydrobromide

PDB Compounds: (A:) Coagulation factor VII light chain

SCOPe Domain Sequences for d5paga_:

Sequence; same for both SEQRES and ATOM records:

>d5paga_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekrna

Timeline for d5paga_:

• d5paga_ first appeared in SCOPe 2.06
  
• d5paga_ appears in SCOPe 2.07