Lineage for d5pb0a_ (5pb0 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031215Domain d5pb0a_: 5pb0 A: [335713]
    Other proteins in same PDB: d5pb0b_
    automated match to d1klil_
    complexed with 7lx, ca, cl, gol, so4

Details for d5pb0a_

PDB Entry: 5pb0 (more details), 1.98 Å

PDB Description: crystal structure of factor viia in complex with 2-(4-ethoxy-3- methoxyphenyl)-2-(isoquinolin-6-ylamino)acetic acid
PDB Compounds: (A:) Coagulation factor VII light chain

SCOPe Domain Sequences for d5pb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pb0a_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d5pb0a_:

Click to download the PDB-style file with coordinates for d5pb0a_.
(The format of our PDB-style files is described here.)

Timeline for d5pb0a_: