| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein RNase H (RNase HI) [53100] (4 species) |
| Species Escherichia coli [TaxId:562] [53101] (33 PDB entries) Uniprot P0A7Y4 |
| Domain d1f21a_: 1f21 A: [33550] |
PDB Entry: 1f21 (more details), 1.4 Å
SCOPe Domain Sequences for d1f21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f21a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyqve
Timeline for d1f21a_: