Lineage for d1f21a_ (1f21 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. Protein RNase H (RNase HI) [53100] (4 species)
  7. Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. Domain d1f21a_: 1f21 A: [33550]

Details for d1f21a_

PDB Entry: 1f21 (more details), 1.4 Å

PDB Description: divalent metal cofactor binding in the kinetic folding trajectory of e. coli ribonuclease hi
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d1f21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f21a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyqve

SCOPe Domain Coordinates for d1f21a_ are not available.

Timeline for d1f21a_: