Lineage for d1f21a_ (1f21 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25267Protein RNase H (RNase HI) [53100] (2 species)
  7. 25268Species Escherichia coli [TaxId:562] [53101] (21 PDB entries)
  8. 25269Domain d1f21a_: 1f21 A: [33550]

Details for d1f21a_

PDB Entry: 1f21 (more details), 1.4 Å

PDB Description: divalent metal cofactor binding in the kinetic folding trajectory of e. coli ribonuclease hi

SCOP Domain Sequences for d1f21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f21a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyqve

SCOP Domain Coordinates for d1f21a_:

Click to download the PDB-style file with coordinates for d1f21a_.
(The format of our PDB-style files is described here.)

Timeline for d1f21a_: