Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein automated matches [190880] (5 species) not a true protein |
Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries) |
Domain d5vnpb_: 5vnp B: [335477] automated match to d1cqwa_ complexed with 9fm, cl |
PDB Entry: 5vnp (more details), 2.23 Å
SCOPe Domain Sequences for d5vnpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vnpb_ c.69.1.8 (B:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]} igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl
Timeline for d5vnpb_: