SCOPe 2.07: Domain d5vnpb_: 5vnp B:

Lineage for d5vnpb_ (5vnp B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries)

8. Domain d5vnpb_: 5vnp B: [335477]
   automated match to d1cqwa_
   complexed with 9fm, cl

Details for d5vnpb_

PDB Entry: 5vnp, 2.23 Å

PDB Description: x-ray crystal structure of halotag bound to the p1 benzoxadiazole fluorogenic ligand

PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d5vnpb_:

Sequence; same for both SEQRES and ATOM records:

>d5vnpb_ c.69.1.8 (B:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl

Timeline for d5vnpb_:

• d5vnpb_ first appeared in SCOPe 2.06
  
• d5vnpb_ appears in the current release, SCOPe 2.08