Lineage for d5t7ed_ (5t7e D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969465Species Streptomyces hygroscopicus [TaxId:1912] [335112] (2 PDB entries)
  8. 2969473Domain d5t7ed_: 5t7e D: [335206]
    automated match to d1yr0a1
    complexed with bng, coa, ppq

Details for d5t7ed_

PDB Entry: 5t7e (more details), 1.8 Å

PDB Description: crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin
PDB Compounds: (D:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5t7ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ed_ d.108.1.0 (D:) automated matches {Streptomyces hygroscopicus [TaxId: 1912]}
padirrateadmpavctivnhyietstvnfrtepqepqewtddlvrlrerypwlvaevdg
evagiayagpwkarnaydwtaestvyvsprhqrtglgstlythllksleaqgfksvvavi
glpndpsvrmhealgyaprgmlraagfkhgnwhdvgfwqldfslpvpprpvlpvt

SCOPe Domain Coordinates for d5t7ed_:

Click to download the PDB-style file with coordinates for d5t7ed_.
(The format of our PDB-style files is described here.)

Timeline for d5t7ed_: