| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Streptomyces hygroscopicus [TaxId:1912] [335112] (2 PDB entries) |
| Domain d5t7eb_: 5t7e B: [335144] automated match to d1yr0a1 complexed with bng, coa, ppq |
PDB Entry: 5t7e (more details), 1.8 Å
SCOPe Domain Sequences for d5t7eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t7eb_ d.108.1.0 (B:) automated matches {Streptomyces hygroscopicus [TaxId: 1912]}
adirrateadmpavctivnhyietstvnfrtepqepqewtddlvrlrerypwlvaevdge
vagiayagpwkarnaydwtaestvyvsprhqrtglgstlythllksleaqgfksvvavig
lpndpsvrmhealgyaprgmlraagfkhgnwhdvgfwqldfslpvpprpvlpvt
Timeline for d5t7eb_: