SCOP 1.55: Domain d1glfz1: 1glf Z:3-253

Lineage for d1glfz1 (1glf Z:3-253)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families)
Family c.55.1.4: Glycerol kinase [53089] (1 protein)
Protein Glycerol kinase [53090] (1 species)
Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
Domain d1glfz1: 1glf Z:3-253 [33515]

Details for d1glfz1

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1glfz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfz1 c.55.1.4 (Z:3-253) Glycerol kinase {Escherichia coli}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

SCOP Domain Coordinates for d1glfz1:

Click to download the PDB-style file with coordinates for d1glfz1.
(The format of our PDB-style files is described here.)

Timeline for d1glfz1: