![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries) |
![]() | Domain d1hkbb1: 1hkb B:16-222 [33483] complexed with bgc, ca, g6p |
PDB Entry: 1hkb (more details), 2.8 Å
SCOPe Domain Sequences for d1hkbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkbb1 c.55.1.3 (B:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk rgdydanivavvndtvgtmmtcgyddq
Timeline for d1hkbb1:
![]() Domains from other chains: (mouse over for more information) d1hkba1, d1hkba2, d1hkba3, d1hkba4 |