Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries) |
Domain d1hkba2: 1hkb A:223-465 [33480] complexed with bgc, ca, g6p |
PDB Entry: 1hkb (more details), 2.8 Å
SCOPe Domain Sequences for d1hkba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkba2 c.55.1.3 (A:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreid rgslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr lae
Timeline for d1hkba2:
View in 3D Domains from other chains: (mouse over for more information) d1hkbb1, d1hkbb2, d1hkbb3, d1hkbb4 |