Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein Major cold shock protein [50283] (4 species) |
Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries) |
Domain d5jx4a1: 5jx4 A:1-64 [334508] Other proteins in same PDB: d5jx4a2, d5jx4b2 automated match to d1c9oa_ complexed with so4; mutant |
PDB Entry: 5jx4 (more details), 1.8 Å
SCOPe Domain Sequences for d5jx4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jx4a1 b.40.4.5 (A:1-64) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} mqrgkvkwfnnekgygfieveggsdvfvhftaiqgfktleegqevsfeivqgnrgpqaan vvkl
Timeline for d5jx4a1: