Lineage for d1c9oa_ (1c9o A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399387Protein Major cold shock protein [50283] (4 species)
  7. 2399388Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)
  8. 2399395Domain d1c9oa_: 1c9o A: [25325]
    complexed with na, trs

Details for d1c9oa_

PDB Entry: 1c9o (more details), 1.17 Å

PDB Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
PDB Compounds: (A:) cold-shock protein

SCOPe Domain Sequences for d1c9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

SCOPe Domain Coordinates for d1c9oa_:

Click to download the PDB-style file with coordinates for d1c9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1c9oa_:

2399395
d1c9oa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1c9ob_