Lineage for d5jx4a1 (5jx4 A:1-64)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789773Protein Major cold shock protein [50283] (4 species)
  7. 2789774Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)
  8. 2789785Domain d5jx4a1: 5jx4 A:1-64 [334508]
    Other proteins in same PDB: d5jx4a2, d5jx4b2
    automated match to d1c9oa_
    complexed with so4; mutant

Details for d5jx4a1

PDB Entry: 5jx4 (more details), 1.8 Å

PDB Description: crystal structure of e36-g37del mutant of the bacillus caldolyticus cold shock protein.
PDB Compounds: (A:) Cold shock protein cspB

SCOPe Domain Sequences for d5jx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jx4a1 b.40.4.5 (A:1-64) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgfktleegqevsfeivqgnrgpqaan
vvkl

SCOPe Domain Coordinates for d5jx4a1:

Click to download the PDB-style file with coordinates for d5jx4a1.
(The format of our PDB-style files is described here.)

Timeline for d5jx4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jx4a2