Lineage for d1deja2 (1dej A:147-375)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 proteins)
  6. 25010Protein Actin [53073] (4 species)
  7. 25030Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (4 PDB entries)
  8. 25036Domain d1deja2: 1dej A:147-375 [33446]
    Other proteins in same PDB: d1dejs_

Details for d1deja2

PDB Entry: 1dej (more details), 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1

SCOP Domain Sequences for d1deja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deja2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum)}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemkaykessaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskheydesgpsivhrkcf

SCOP Domain Coordinates for d1deja2:

Click to download the PDB-style file with coordinates for d1deja2.
(The format of our PDB-style files is described here.)

Timeline for d1deja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1deja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1dejs_