| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
| Protein automated matches [226902] (12 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:485] [334375] (1 PDB entry) |
| Domain d5vk4a2: 5vk4 A:169-344 [334376] Other proteins in same PDB: d5vk4a1, d5vk4b1 automated match to d3p4ea2 complexed with anp, mg |
PDB Entry: 5vk4 (more details), 2.65 Å
SCOPe Domain Sequences for d5vk4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vk4a2 d.139.1.0 (A:169-344) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tglsvgagdmvlglasngahsngyslirkiierdnpdldaefdngktlreaviaptrlyv
kpilaalekftikgmahitgggitenvprvlpkntvaqidaeswelpklfqwlqkagnve
tqemyrtfncgigmvvivaaedadavrsflsgqgetvyrlgcirerqgnehqtqva
Timeline for d5vk4a2: