Lineage for d3p4ea2 (3p4e A:172-346)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584750Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2584751Protein automated matches [226902] (12 species)
    not a true protein
  7. 2584794Species Vibrio cholerae [TaxId:666] [225999] (1 PDB entry)
  8. 2584795Domain d3p4ea2: 3p4e A:172-346 [214656]
    Other proteins in same PDB: d3p4ea1
    automated match to d1clia2
    complexed with amp, cit, edo, gol

Details for d3p4ea2

PDB Entry: 3p4e (more details), 1.77 Å

PDB Description: phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d3p4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4ea2 d.139.1.0 (A:172-346) automated matches {Vibrio cholerae [TaxId: 666]}
dgskvqvgdaliavgssgphsngyslvrkilevskadknerlagktigehllaptkiyik
sglkliaehdihaishitgggfweniprvlpegtkavidgkswewpvifqwlqekgnvtt
hemyrtfncgvgliialpkdqanaavallqaegetawvigeiaaansneaqvein

SCOPe Domain Coordinates for d3p4ea2:

Click to download the PDB-style file with coordinates for d3p4ea2.
(The format of our PDB-style files is described here.)

Timeline for d3p4ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p4ea1