| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
| Protein automated matches [226902] (6 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [225999] (1 PDB entry) |
| Domain d3p4ea2: 3p4e A:172-346 [214656] Other proteins in same PDB: d3p4ea1 automated match to d1clia2 complexed with amp, cit, edo, gol |
PDB Entry: 3p4e (more details), 1.77 Å
SCOPe Domain Sequences for d3p4ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4ea2 d.139.1.0 (A:172-346) automated matches {Vibrio cholerae [TaxId: 666]}
dgskvqvgdaliavgssgphsngyslvrkilevskadknerlagktigehllaptkiyik
sglkliaehdihaishitgggfweniprvlpegtkavidgkswewpvifqwlqekgnvtt
hemyrtfncgvgliialpkdqanaavallqaegetawvigeiaaansneaqvein
Timeline for d3p4ea2: