SCOPe 2.08: Domain d3p4ea2: 3p4e A:172-346

Lineage for d3p4ea2 (3p4e A:172-346)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [225999] (1 PDB entry)

8. Domain d3p4ea2: 3p4e A:172-346 [214656]
   Other proteins in same PDB: d3p4ea1
   automated match to d1clia2
   complexed with amp, cit, edo, gol

Details for d3p4ea2

PDB Entry: 3p4e, 1.77 Å

PDB Description: phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae

PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d3p4ea2:

Sequence; same for both SEQRES and ATOM records:

>d3p4ea2 d.139.1.0 (A:172-346) automated matches {Vibrio cholerae [TaxId: 666]}
dgskvqvgdaliavgssgphsngyslvrkilevskadknerlagktigehllaptkiyik
sglkliaehdihaishitgggfweniprvlpegtkavidgkswewpvifqwlqekgnvtt
hemyrtfncgvgliialpkdqanaavallqaegetawvigeiaaansneaqvein

Timeline for d3p4ea2:

• d3p4ea2 first appeared in SCOPe 2.03
  
• d3p4ea2 appears in SCOPe 2.07