Lineage for d5vk4a1 (5vk4 A:15-168)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201987Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2202063Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2202064Protein automated matches [226901] (9 species)
    not a true protein
  7. 2202091Species Neisseria gonorrhoeae [TaxId:485] [334373] (1 PDB entry)
  8. 2202092Domain d5vk4a1: 5vk4 A:15-168 [334374]
    Other proteins in same PDB: d5vk4a2, d5vk4b2
    automated match to d3p4ea1
    complexed with anp, mg

Details for d5vk4a1

PDB Entry: 5vk4 (more details), 2.65 Å

PDB Description: crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5vk4a1:

Sequence, based on SEQRES records: (download)

>d5vk4a1 d.79.4.0 (A:15-168) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
dagdqlvekikpfakrtmrpevlgdlggfgalveigkkyqnpvlvsgtdgvgtklklafd
wdkhdtvgidlvamsvndilvqgaeplffldyfacgkldvpratdvikgiaqgceesgca
liggetaempgmypvgeydlagfavgvvekenvi

Sequence, based on observed residues (ATOM records): (download)

>d5vk4a1 d.79.4.0 (A:15-168) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
dagdqlvekikpfakrtmrpevlgalveigkkyqnpvlvsgtdgvgtklklafdwdkhdt
vgidlvamsvndilvqgaeplffldyfacgkldvpratdvikgiaqgceesgcaligget
aempgmypvgeydlagfavgvvekenvi

SCOPe Domain Coordinates for d5vk4a1:

Click to download the PDB-style file with coordinates for d5vk4a1.
(The format of our PDB-style files is described here.)

Timeline for d5vk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vk4a2