SCOPe 2.08: Domain d5v4kb_: 5v4k B:

Lineage for d5v4kb_ (5v4k B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)

8. Domain d5v4kb_: 5v4k B: [334327]
   automated match to d3waoa_
   complexed with gol, so4

Details for d5v4kb_

PDB Entry: 5v4k, 2.1 Å

PDB Description: crystal structure of nedd4 lir-fused human lc3b_2-119

PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5v4kb_:

Sequence; same for both SEQRES and ATOM records:

>d5v4kb_ d.15.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enweiigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
asqe

Timeline for d5v4kb_:

• d5v4kb_ first appeared in SCOPe 2.06
  
• d5v4kb_ appears in SCOPe 2.07