Lineage for d1hjoa1 (1hjo A:3-188)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [53071] (1 PDB entry) 
Domain d1hjoa1: 1hjo A:3-188 [33425]
Details for d1hjoa1
PDB Entry: 1hjo (more details), 2.3 Å
PDB Description: ATPase domain of human heat shock 70kDa protein 1
SCOP Domain Sequences for d1hjoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjoa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens)}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldrt
SCOP Domain Coordinates for d1hjoa1:
Click to download the PDB-style file with coordinates for d1hjoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hjoa1:
- d1hjoa1 appears in SCOP 1.57
- d1hjoa1 appears in the current release, SCOPe 2.08
View in 3D
