Lineage for d1ats_2 (1ats 189-383)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 proteins)
  6. 25045Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 25046Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries)
  8. 25094Domain d1ats_2: 1ats 189-383 [33424]

Details for d1ats_2

PDB Entry: 1ats (more details), 2.43 Å

PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis

SCOP Domain Sequences for d1ats_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ats_2 c.55.1.1 (189-383) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggefdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaailsgd

SCOP Domain Coordinates for d1ats_2:

Click to download the PDB-style file with coordinates for d1ats_2.
(The format of our PDB-style files is described here.)

Timeline for d1ats_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ats_1