Lineage for d1ngd_1 (1ngd 4-188)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries) 
Domain d1ngd_1: 1ngd 4-188 [33417]
Details for d1ngd_1
PDB Entry: 1ngd (more details), 2.44 Å
PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment
SCOP Domain Sequences for d1ngd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngd_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk
SCOP Domain Coordinates for d1ngd_1:
Click to download the PDB-style file with coordinates for d1ngd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ngd_1:
- d1ngd_1 appears in SCOP 1.57
- d1ngd_1 appears in the current release, SCOPe 2.08, called d1ngda1
View in 3D
