![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
![]() | Domain d1ngfa1: 1ngf A:3-188 [33405] complexed with atp; mutant |
PDB Entry: 1ngf (more details), 2.17 Å
SCOPe Domain Sequences for d1ngfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngfa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia ygldkk
Timeline for d1ngfa1: