Lineage for d3hsc_2 (3hsc 189-384)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries) 
Domain d3hsc_2: 3hsc 189-384 [33400]
Details for d3hsc_2
PDB Entry: 3hsc (more details), 1.9 Å
PDB Description: three-dimensional structure of the atpase fragment of a 70k heat-shock cognate protein
SCOP Domain Sequences for d3hsc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hsc_2 c.55.1.1 (189-384) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaailsgdk
SCOP Domain Coordinates for d3hsc_2:
Click to download the PDB-style file with coordinates for d3hsc_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hsc_2:
- d3hsc_2 appears in SCOP 1.57
- d3hsc_2 appears in the current release, SCOPe 2.08, called d3hsca2
View in 3D
