Lineage for d1qqoa1 (1qqo A:4-188)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries) 
Domain d1qqoa1: 1qqo A:4-188 [33395]
Details for d1qqoa1
PDB Entry: 1qqo (more details), 1.9 Å
PDB Description: e175s mutant of bovine 70 kilodalton heat shock protein
SCOP Domain Sequences for d1qqoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqoa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgatvtnavvtvpayfndsqrqatkdagtiaglnvlriinsptaaaiay
gldka
SCOP Domain Coordinates for d1qqoa1:
Click to download the PDB-style file with coordinates for d1qqoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqoa1:
- d1qqoa1 appears in SCOP 1.57
- d1qqoa1 appears in the current release, SCOPe 2.08
View in 3D
