Lineage for d1kaz_2 (1kaz 189-381)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 proteins)
  6. 25045Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 25046Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries)
  8. 25058Domain d1kaz_2: 1kaz 189-381 [33384]

Details for d1kaz_2

PDB Entry: 1kaz (more details), 1.7 Å

PDB Description: 70kd heat shock cognate protein atpase domain, k71e mutant

SCOP Domain Sequences for d1kaz_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaz_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOP Domain Coordinates for d1kaz_2:

Click to download the PDB-style file with coordinates for d1kaz_2.
(The format of our PDB-style files is described here.)

Timeline for d1kaz_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kaz_1