Lineage for d2bupa1 (2bup A:4-188)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries) 
Domain d2bupa1: 2bup A:4-188 [33379]
Details for d2bupa1
PDB Entry: 2bup (more details), 1.7 Å
PDB Description: t13g mutant of the atpase fragment of bovine hsc70
SCOP Domain Sequences for d2bupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlggtyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk
SCOP Domain Coordinates for d2bupa1:
Click to download the PDB-style file with coordinates for d2bupa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bupa1:
- d2bupa1 appears in SCOP 1.57
- d2bupa1 appears in the current release, SCOPe 2.08
View in 3D
