Lineage for d1taqa2 (1taq A:10-173)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011866Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1011867Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 1011923Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1011924Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 1011925Species Thermus aquaticus [TaxId:271] [53049] (3 PDB entries)
  8. 1011927Domain d1taqa2: 1taq A:10-173 [33352]
    Other proteins in same PDB: d1taqa1, d1taqa3, d1taqa4
    complexed with bgl, zn

Details for d1taqa2

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase
PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa2:

Sequence, based on SEQRES records: (download)

>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records): (download)

>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

SCOPe Domain Coordinates for d1taqa2:

Click to download the PDB-style file with coordinates for d1taqa2.
(The format of our PDB-style files is described here.)

Timeline for d1taqa2: