SCOPe 2.08: Domain d1taqa2: 1taq A:10-173

Lineage for d1taqa2 (1taq A:10-173)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)

8. Domain d1taqa2: 1taq A:10-173 [33352]
   Other proteins in same PDB: d1taqa1, d1taqa3, d1taqa4
   complexed with bgl, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1taqa2

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa2:

Sequence, based on SEQRES records:

>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records):

>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

Timeline for d1taqa2:

• d1taqa2 first appeared (with stable ids) in SCOP 1.55, called d1taq_2
  
• d1taqa2 appears in SCOPe 2.07