Lineage for d1taqa1 (1taq A:174-289)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917246Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 917247Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 917248Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 917249Species Thermus aquaticus [TaxId:271] [47812] (3 PDB entries)
  8. 917251Domain d1taqa1: 1taq A:174-289 [18082]
    Other proteins in same PDB: d1taqa2, d1taqa3, d1taqa4
    complexed with bgl, zn

Details for d1taqa1

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase
PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taqa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOPe Domain Coordinates for d1taqa1:

Click to download the PDB-style file with coordinates for d1taqa1.
(The format of our PDB-style files is described here.)

Timeline for d1taqa1: