SCOPe 2.02: Domain d1taqa1: 1taq A:174-289

Lineage for d1taqa1 (1taq A:174-289)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47812] (3 PDB entries)

8. Domain d1taqa1: 1taq A:174-289 [18082]
   Other proteins in same PDB: d1taqa2, d1taqa3, d1taqa4
   complexed with bgl, zn

Details for d1taqa1

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa1:

Sequence; same for both SEQRES and ATOM records:

>d1taqa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

Timeline for d1taqa1:

• d1taqa1 first appeared (with stable ids) in SCOP 1.55, called d1taq_1
  
• d1taqa1 appears in SCOPe 2.01
  
• d1taqa1 appears in SCOPe 2.03
  
• d1taqa1 appears in the current release, SCOPe 2.08