Lineage for d5lajw_ (5laj W:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2228232Domain d5lajw_: 5laj W: [333431]
    Other proteins in same PDB: d5lajb_, d5lajc_, d5lajd_, d5laje_, d5lajf_, d5lajg_, d5lajh_, d5lajm_, d5lajp_, d5lajq_, d5lajr_, d5lajs_, d5lajt_, d5laju_, d5lajv_
    automated match to d1g0ui_
    complexed with mg

Details for d5lajw_

PDB Entry: 5laj (more details), 2.9 Å

PDB Description: ligand-induced lys33-thr1 crosslinking at the yeast proteasomal subunit beta5 by sulfonate esters
PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5lajw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lajw_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d5lajw_:

Click to download the PDB-style file with coordinates for d5lajw_.
(The format of our PDB-style files is described here.)

Timeline for d5lajw_: