Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5lajc_: 5laj C: [333493] Other proteins in same PDB: d5laja_, d5lajb_, d5lajf_, d5lajg_, d5lajh_, d5laji_, d5lajj_, d5lajk_, d5lajl_, d5lajm_, d5lajn_, d5lajo_, d5lajp_, d5lajt_, d5laju_, d5lajv_, d5lajw_, d5lajx_, d5lajy_, d5lajz_ automated match to d1iruf_ complexed with mg |
PDB Entry: 5laj (more details), 2.9 Å
SCOPe Domain Sequences for d5lajc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lajc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5lajc_: