![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) ![]() |
![]() | Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins) automatically mapped to Pfam PF05367 |
![]() | Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species) forms dimer by swapping the common core elements |
![]() | Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries) |
![]() | Domain d1fzrd_: 1fzr D: [33339] CASP4 |
PDB Entry: 1fzr (more details), 2.1 Å
SCOPe Domain Sequences for d1fzrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzrd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]} sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke vpfdrlkrk
Timeline for d1fzrd_: