SCOPe 2.05: Domain d1fzrd_: 1fzr D:

Lineage for d1fzrd_ (1fzr D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
   automatically mapped to Pfam PF05367

6. Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
   forms dimer by swapping the common core elements

7. Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)

8. Domain d1fzrd_: 1fzr D: [33339]
   CASP4

Details for d1fzrd_

PDB Entry: 1fzr, 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i

PDB Compounds: (D:) endonuclease I

SCOPe Domain Sequences for d1fzrd_:

Sequence; same for both SEQRES and ATOM records:

>d1fzrd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

Timeline for d1fzrd_:

• d1fzrd_ first appeared (with stable ids) in SCOP 1.55
  
• d1fzrd_ appears in SCOPe 2.04
  
• d1fzrd_ appears in SCOPe 2.06
  
• d1fzrd_ appears in the current release, SCOPe 2.08