Lineage for d1fzrd_ (1fzr D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490381Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
    automatically mapped to Pfam PF05367
  6. 2490382Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 2490383Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 2490391Domain d1fzrd_: 1fzr D: [33339]
    CASP4

Details for d1fzrd_

PDB Entry: 1fzr (more details), 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i
PDB Compounds: (D:) endonuclease I

SCOPe Domain Sequences for d1fzrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzrd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOPe Domain Coordinates for d1fzrd_:

Click to download the PDB-style file with coordinates for d1fzrd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzrd_: