Lineage for d1fzrc_ (1fzr C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24929Family c.52.1.17: Holliday junction resolvase (Endonuclease I) [53029] (1 protein)
  6. 24930Protein Holliday junction resolvase (Endonuclease I) [53030] (1 species)
  7. 24931Species Bacteriophage T7 [TaxId:10760] [53031] (1 PDB entry)
  8. 24934Domain d1fzrc_: 1fzr C: [33338]

Details for d1fzrc_

PDB Entry: 1fzr (more details), 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i

SCOP Domain Sequences for d1fzrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzrc_ c.52.1.17 (C:) Holliday junction resolvase (Endonuclease I) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOP Domain Coordinates for d1fzrc_:

Click to download the PDB-style file with coordinates for d1fzrc_.
(The format of our PDB-style files is described here.)

Timeline for d1fzrc_: