SCOPe 2.06: Domain d5b55b_: 5b55 B:

Lineage for d5b55b_ (5b55 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (33 species)
   not a true protein

7. Species Fusobacterium nucleatum [TaxId:190304] [333378] (2 PDB entries)

8. Domain d5b55b_: 5b55 B: [333379]
   automated match to d5d86a_
   complexed with 0jo, peg, plp; mutant

Details for d5b55b_

PDB Entry: 5b55, 2.14 Å

PDB Description: crystal structure of hydrogen sulfide-producing enzyme (fn1055) d232n mutant in complexed with alpha-aminoacrylate intermediate: lysine- dimethylated form

PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d5b55b_:

Sequence; same for both SEQRES and ATOM records:

>d5b55b_ c.79.1.0 (B:) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
qkkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayekne
ikkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrke
ggflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfvag
vgtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisnefipdlvkld
kldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddnk
kylstdlmreekvkedflskditlkeiknvlrv

Timeline for d5b55b_:

• d5b55b_ is new in SCOPe 2.06-stable
  
• d5b55b_ appears in SCOPe 2.07
  
• d5b55b_ appears in the current release, SCOPe 2.08