![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Fusobacterium nucleatum [TaxId:190304] [333378] (6 PDB entries) |
![]() | Domain d5b55b_: 5b55 B: [333379] automated match to d5d86a_ complexed with 0jo, peg, plp; mutant |
PDB Entry: 5b55 (more details), 2.14 Å
SCOPe Domain Sequences for d5b55b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b55b_ c.79.1.0 (B:) automated matches {Fusobacterium nucleatum [TaxId: 190304]} qkkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayekne ikkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrke ggflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfvag vgtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisnefipdlvkld kldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddnk kylstdlmreekvkedflskditlkeiknvlrv
Timeline for d5b55b_: