Lineage for d5b55b_ (5b55 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907876Species Fusobacterium nucleatum [TaxId:190304] [333378] (6 PDB entries)
  8. 2907888Domain d5b55b_: 5b55 B: [333379]
    automated match to d5d86a_
    complexed with 0jo, peg, plp; mutant

Details for d5b55b_

PDB Entry: 5b55 (more details), 2.14 Å

PDB Description: crystal structure of hydrogen sulfide-producing enzyme (fn1055) d232n mutant in complexed with alpha-aminoacrylate intermediate: lysine- dimethylated form
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d5b55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b55b_ c.79.1.0 (B:) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
qkkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayekne
ikkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrke
ggflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfvag
vgtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisnefipdlvkld
kldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddnk
kylstdlmreekvkedflskditlkeiknvlrv

SCOPe Domain Coordinates for d5b55b_:

Click to download the PDB-style file with coordinates for d5b55b_.
(The format of our PDB-style files is described here.)

Timeline for d5b55b_: