Lineage for d1fiud_ (1fiu D:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein) Protein Restriction endonuclease NgoIV [53009] (1 species) Species Neisseria gonorrhoeae [53010] (1 PDB entry) 
Domain d1fiud_: 1fiu D: [33320]
Details for d1fiud_
PDB Entry: 1fiu (more details), 1.6 Å
PDB Description: tetrameric restriction endonuclease ngomiv in complex with cleaved dna
SCOP Domain Sequences for d1fiud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiud_ c.52.1.10 (D:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae}
mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl
pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka
aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll
hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc
vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav
SCOP Domain Coordinates for d1fiud_:
Click to download the PDB-style file with coordinates for d1fiud_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fiud_:
- d1fiud_ appears in SCOP 1.57
- d1fiud_ appears in the current release, SCOPe 2.08
View in 3D
