Lineage for d1fiuc_ (1fiu C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604360Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein)
    automatically mapped to Pfam PF09015
  6. 1604361Protein Restriction endonuclease NgoIV [53009] (1 species)
  7. 1604362Species Neisseria gonorrhoeae [TaxId:485] [53010] (1 PDB entry)
  8. 1604365Domain d1fiuc_: 1fiu C: [33319]
    protein/DNA complex; complexed with acy, mg

Details for d1fiuc_

PDB Entry: 1fiu (more details), 1.6 Å

PDB Description: tetrameric restriction endonuclease ngomiv in complex with cleaved dna
PDB Compounds: (C:) type II restriction enzyme ngomi

SCOPe Domain Sequences for d1fiuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiuc_ c.52.1.10 (C:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae [TaxId: 485]}
mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl
pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka
aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll
hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc
vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav

SCOPe Domain Coordinates for d1fiuc_:

Click to download the PDB-style file with coordinates for d1fiuc_.
(The format of our PDB-style files is described here.)

Timeline for d1fiuc_: